PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g03620.2.p
Common NameBRADI_1g03620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 649aa    MW: 72157.6 Da    PI: 6.3146
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g03620.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.31.8e-1012876222339
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cA+a + +d ++  +lL+++++++s  gd+ qRla+yf+++L+arla+++s++y++l +++++   +++ l+a++l++ v+P+ k+s
  Bradi1g03620.2.p 287 TTLLIHCAQATAIDDYRNSVELLKQIRQHSSALGDAGQRLAHYFANGLEARLAGTGSTIYRSLVAQRNT---TADILKAFELYVTVCPFNKLS 376
                       689************************************************************999888...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        +  N+aIl+a +  +r+Hi+D++i  G+QWp ++q +a R +gpp+lRiTg++ p++g   +e++e+tg+rL+++A++++vpfe+++ +a +
  Bradi1g03620.2.p 377 KFFSNEAILNASKDVTRLHIVDYGIRWGFQWPIFMQRIARRLGGPPRLRITGIDLPQPGfrPAERVEATGQRLREYARTFKVPFEYHA-IAAK 468
                       **********************************************************9*****************************.799* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       ++++++e+L+++++E l+Vn+ + + +++de+v+ +s+r +vL+++++++P+++++   +  +n++ F++rf eal y+s+lfd+le++ +r 
  Bradi1g03620.2.p 469 WDTVRVEDLKIDKDELLIVNCTFLMRHMMDETVTDDSPRMRVLNTIRKMNPHMFIHGVVNGTYNAPFFVTRFKEALFYFSSLFDMLETTSSRL 561
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                       +e+r  +Er ++gre+ nvvaceg+er+er et+++W+ r  +aGF+++pl+++++k+a++
  Bradi1g03620.2.p 562 DEHRLLIERDFFGREALNVVACEGTERVERPETYKQWQVRNIRAGFRQLPLNQDTVKKARY 622
                       *********************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.277260637IPR005202Transcription factor GRAS
PfamPF035146.1E-99287622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MGSCEDVDYG DIFSVTNPAA APNYMFNFSP LQQQQQHPHL RFPAAPHGFH PGSVGPSPPS  60
GPPALGQTPS PSSSITTAEL DAPEDVTGDA VLAYINQFLL EDEDEDSCPG ASSAATDPQQ  120
DSALLAVEKP FVDIIADAAP AGACRQNNNP WMDPCCGFAG NDAGVFVGRQ TQTSSCQIVP  180
CEEEPVKLEG DCAVHKGRKN RHGDRGVELE EEEERRSKQS AVCEEETVRE MFDKVLLCDG  240
VNCILQSPLP AEAEVSAVYV KGSGNKRGRK KGKPGAAAAE EESVDLTTLL IHCAQATAID  300
DYRNSVELLK QIRQHSSALG DAGQRLAHYF ANGLEARLAG TGSTIYRSLV AQRNTTADIL  360
KAFELYVTVC PFNKLSKFFS NEAILNASKD VTRLHIVDYG IRWGFQWPIF MQRIARRLGG  420
PPRLRITGID LPQPGFRPAE RVEATGQRLR EYARTFKVPF EYHAIAAKWD TVRVEDLKID  480
KDELLIVNCT FLMRHMMDET VTDDSPRMRV LNTIRKMNPH MFIHGVVNGT YNAPFFVTRF  540
KEALFYFSSL FDMLETTSSR LDEHRLLIER DFFGREALNV VACEGTERVE RPETYKQWQV  600
RNIRAGFRQL PLNQDTVKKA RYKGISRCDI LAAGTTKRHI WISGVRQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-452906148330GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227583.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE581e-151SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0Q3KMR90.0A0A0Q3KMR9_BRADI; Uncharacterized protein
STRINGBRADI1G03620.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-149SCARECROW-like 14